Skip to main content

Table 1 FN peptide sequences in the rat sciatic nerve

From: The alternatively spliced fibronectin CS1 isoform regulates IL-17A levels and mechanical allodynia after peripheral nerve injury

  Peptide sequence   Peptide sequence
1 69TYLGNALVCTCYGGSR84 27 1446TGLDSPTGFDSSDVTANSFTVHWVAPR1472
2 85GFNCESKPEPEETCFDK101 28 1473APITGYIIR1481
3 85GFNCESKPEPEETCFDKYTGNTYK108 29 1525EESPPLIGQQSTVSDVPR1542
4 118DSMIWDCTCIGAGR131 30 1570ITYGETGGNSPVQEFTVPGSK1590
5 118DSMIWDCTCIGAGRGRISCTIANR141 31 1591STATINNIKPGADYTITLYAVTGR1614
6 254GNLLQCVCTGNGR266 32 1615GDSPASSKPVSINYQTEIDKPSQMQVTDVQDNSISVR1651
7 274HVLQSASAGSGSFTDVR290 33 1652WLPSTSPVTGYR1663
8 291TAIYQPQTHPQPAPYGHCVTDSGVVYSVGMQWLK324 34 1708NGESQPLVQTAVTNIDRPK1726
9 370TFYSCTTEGR379 35 1727GLAFTDVDVDSIK1739
10 380QDGHLWCSTTSNYEQDQK397 36 1820FTQVSPTTLTAQWTAPSVK1838
11 398YSFCTDHAVLVQTR411 37 1857EINLSPDSTSVIVSGLM[147]VATK1877
12 458FGFCPMAAHEEICTTNEGVMYR479 38 1878YEVSVYALK1886
13 504GQWACIPYSQLR515 39 1887DTLTSRPAQGVVTTLENVSPPR1908
14 670GLTPGVIYEGQLISIQQYGHQEVTR694 40 1887DTLTSRPAQGVVTTLENVSPPRR1909
15 785YIVNVYQISEEGK797 41 1926TKTETITGFQVDAIPANGQTPVQR1949
16 798QSLILSTSQTTAPDAPPDPTVDQVDDTSIVVR829 42 1928TETITGFQVDAIPANGQTPVQR1949
17 821TQVSPTTLTAQWTAPSVK838 43 1957SYTITGLQPGTDYK1970
18 830WSRPQAPITGYR841 44 1982SSPVVIDASTAIDAPSNLR2000
19 881AVEENQESTPVFIQQETTGVPR902 45 2001FLTTTPNSLLVSWQAPR2017
20 911DLQFVEVTDVK921 46 2008SLLVSWQAPR2017
21 938VDVLPVNLPGEHGQR952 47 2081TDELPQLVTLPHPNLHGPEILDVPSTVQK2109
22 1011TVLVTWTPPR1020 48 2161LRPRPYLPNVDEEVQIGHVPR2181
23 1054NLQPGSEYTVTLMAVK1069 49 2165PYLPNVDEEVQIGHVPR2181
24 1116LGVRPSQGGEAPR1128 50 2255GVTYNIIVEALHNQR2269
25 1254ESAPISDTVIPEVPQLTDLSFVDITDSSIGLR1285 51 2321LTCQCLGFGSGHFR2334
26 1365FTNIGPDTMR1374 52 2401EYLGAICSCTCFGGQR2416
27 1446TGLDSPTGFDSSDVTANSFTVHWVAPR1472 53 2452TNTNVNCPIECFMPLDVQADRDDSRE2477
  1. 2D-LC-MS/MS of sciatic nerve samples was performed at day 7 after sham surgery or CCI. The sequence of the 53 identified FN peptides (with the total coverage over 35 %) is shown. The presence of the TDELPQLVTLPHPNLHGPEI LDV PSTVQK 2081–2109 peptide (#47) that included the CS1 sequence (italicized) implied that the 2477 residue long rat FN-CS1 splice variant (GeneBank #P04937.2) was present in our nerve samples